PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588466.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 264aa    MW: 30080.8 Da    PI: 5.1059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588466.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd  lv +++++G g+W++ +++ g+ R++k+c++rw++yl
   XP_013588466.1 14 KGEWTAEEDRMLVAYINEYGLGDWRAMPKRAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding56.66.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E++ +++ + +lG++ W++Ia++m+ +Rt++++k++w++ 
   XP_013588466.1  67 RGKFTPQEEKDIIKFHSLLGNR-WAAIAKEMP-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.664961IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-141363IPR001005SANT/Myb domain
PfamPF002495.0E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-231568IPR009057Homeodomain-like
CDDcd001676.03E-111661No hitNo description
PROSITE profilePS5129425.17962116IPR017930Myb domain
SMARTSM007175.8E-1666114IPR001005SANT/Myb domain
PfamPF002495.8E-1767111IPR001005SANT/Myb domain
CDDcd001672.83E-1069109No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2569117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRTTWYDDE GLKKGEWTAE EDRMLVAYIN EYGLGDWRAM PKRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TPQEEKDIIK FHSLLGNRWA AIAKEMPNRT DNDIKNHWNS CLKKRLVRSG  120
IDPMTHQPVV NVKANSSSTT SSPTLTPSSS STTSSFSSTS SSRLLNRLAA EISSRKQGFD  180
RIKNVILSEP RQAVEEDKLM ISSKEEEEEV DGCFMEIDDN LISTTSLYEL LSEPYDMYQS  240
DFGLEVDDQF DLFLEIPSLG QDLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588466.10.0PREDICTED: transcription factor MYB122-like isoform X2
RefseqXP_013682495.10.0PREDICTED: transcription factor MYB122-like isoform X2
RefseqXP_013682496.10.0PREDICTED: transcription factor MYB122-like isoform X3
SwissprotQ9C9C89e-61MY122_ARATH; Transcription factor MYB122
TrEMBLA0A078D9B80.0A0A078D9B8_BRANA; BnaC06g23040D protein
TrEMBLA0A0D3CWP00.0A0A0D3CWP0_BRAOL; Uncharacterized protein
STRINGBra003801.1-P1e-170(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-101myb domain protein 95